Recombinant Human SOD2, His-tagged
Cat.No. : | SOD2-30343TH |
Product Overview : | Recombinant full length Human Superoxide Dismutase 2 with His tag; 219 amino acids with tag, MWt 24.4 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMKHSLPDLPYDYGALEPHIN AQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIA LQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKR DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAA CPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKA IWNVINWENVTERYMACKK |
Sequence Similarities : | Belongs to the iron/manganese superoxide dismutase family. |
Gene Name : | SOD2 superoxide dismutase 2, mitochondrial [ Homo sapiens ] |
Official Symbol : | SOD2 |
Synonyms : | SOD2; superoxide dismutase 2, mitochondrial; superoxide dismutase [Mn], mitochondrial; |
Gene ID : | 6648 |
mRNA Refseq : | NM_000636 |
Protein Refseq : | NP_000627 |
MIM : | 147460 |
Uniprot ID : | P04179 |
Chromosome Location : | 6q25 |
Pathway : | FoxO family signaling, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Oxidative Stress, organism-specific biosystem; Peroxisome, organism-specific biosystem; |
Function : | DNA binding; identical protein binding; manganese ion binding; manganese ion binding; metal ion binding; |
Products Types
◆ Recombinant Protein | ||
Sod2-6041M | Recombinant Mouse Sod2 Protein, Myc/DDK-tagged | +Inquiry |
SOD2-5326R | Recombinant Rat SOD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOD2-2540H | Recombinant Human SOD2 protein(31-210 aa), C-His-tagged | +Inquiry |
SOD2-8569M | Recombinant Mouse SOD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOD2-700C | Recombinant Cynomolgus Monkey SOD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
SOD2-1575HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
SOD2-1574HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket