Recombinant Human SOD2 protein(31-210 aa), C-His-tagged
| Cat.No. : | SOD2-2540H |
| Product Overview : | Recombinant Human SOD2 protein(P04179)(31-210 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 31-210 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | LPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINW |
| Gene Name | SOD2 superoxide dismutase 2, mitochondrial [ Homo sapiens ] |
| Official Symbol | SOD2 |
| Synonyms | SOD2; superoxide dismutase 2, mitochondrial; superoxide dismutase [Mn], mitochondrial; indophenoloxidase B; Mn superoxide dismutase; mangano-superoxide dismutase; manganese-containing superoxide dismutase; IPOB; MNSOD; MVCD6; |
| Gene ID | 6648 |
| mRNA Refseq | NM_000636 |
| Protein Refseq | NP_000627 |
| MIM | 147460 |
| UniProt ID | P04179 |
| ◆ Recombinant Proteins | ||
| SOD2-8569M | Recombinant Mouse SOD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SOD2-1039H | Recombinant Human SOD2 | +Inquiry |
| SOD2-2541H | Recombinant Human SOD2 protein(25-222 aa), N-GST-tagged | +Inquiry |
| SOD2-738H | Recombinant Human SOD2, MYC-DDK-tagged | +Inquiry |
| SOD2-1397HFL | Recombinant Full Length Human SOD2 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOD2-1574HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
| SOD2-1575HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
| SOD2-432HKCL | Human SOD2 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOD2 Products
Required fields are marked with *
My Review for All SOD2 Products
Required fields are marked with *
