Recombinant Human SOD2 protein(31-210 aa), C-His-tagged

Cat.No. : SOD2-2540H
Product Overview : Recombinant Human SOD2 protein(P04179)(31-210 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 31-210 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : LPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINW
Gene Name SOD2 superoxide dismutase 2, mitochondrial [ Homo sapiens ]
Official Symbol SOD2
Synonyms SOD2; superoxide dismutase 2, mitochondrial; superoxide dismutase [Mn], mitochondrial; indophenoloxidase B; Mn superoxide dismutase; mangano-superoxide dismutase; manganese-containing superoxide dismutase; IPOB; MNSOD; MVCD6;
Gene ID 6648
mRNA Refseq NM_000636
Protein Refseq NP_000627
MIM 147460
UniProt ID P04179

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOD2 Products

Required fields are marked with *

My Review for All SOD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon