Recombinant Sesamum indicum Oleosin L Protein, N-10×His tagged
Cat.No. : | Oleosin L-04S |
Product Overview : | Recombinant Sesamum indicum Oleosin L Protein with N-10×His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Oleosin is an important protein constituent of the oil body membrane. |
Source : | E. coli |
Species : | Sesamum indicum |
Tag : | N-10×His |
Molecular Mass : | 18 kDa |
AA Sequence : | MAEHYGQQQQTRAPHLQLQPRAQRV VKAATAVTAGGSLLVLSGLTLAGTV IALTIATPLLVIFSPVLVPAVITIF LLGAGFLASGGFGVAALSVLSWIYR YLTGKHPPGADQLESAKTKLASKAR EMKDRAEQFSQQPVAGSQTS |
Purity : | ≥95% by SDS-PAGE |
Applications : | MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQPVAGSQTS |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Lyophilized from PBS,0.05% Brij-78, 6% Trehalose, pH7.4 The volume before lyophilization is 100ul/vial. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Official Symbol : | Oleosin L |
Synonyms : | Oleosin L; OLEL |
Official Symbol : | Oleosin L |
Synonyms : | Oleosin L; OLEL |
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All Oleosin L Products
Required fields are marked with *
My Review for All Oleosin L Products
Required fields are marked with *
0
Inquiry Basket