"ECHDC1" Related Products

Expand

Recombinant Human Enoyl CoA Hydratase Domain Containing 1, His-tagged

Cat. No.: ECHDC1-1924H
Product Overview: Recombinant humanECHDC1 protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description: ECHDC1,also known as enoyl CoA hydratase domain containing 1, belongs to theenoyl-CoA hydratase/isomerase family. Enoyl-CoA hydratase is an enzyme thathydrates the double bond between the second and third carbons on acyl-CoA.This enzyme is essential to metabolizing fatty acids to produce both acetylCoA and energy.
Form: Liquid. 20mMTris-HCl buffer (pH8.0) containing 10% glycerol 1mM DTT, 0.1M NaCl.
Molecular Weight: 35.8kDa(327aa) confirmed by MALDI-TOF.
Purity: > 95%by SDS-PAGE
Concentration: 1.0mg/ml (determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MALKQEMAKS LLKTASLSGR TKLLHQTGLS LYSTSHGFYE EEVKKTLQQFPGGSIDLQKE DNGIGILTLN NPSRMNAFSG VMMLQLLEKV IELENWTEGKGLIVRGAKNT FSSGSDLNAV KSLGTPEDGM AVCMFMQNTL TRFMRLPLIS VALVQGWALG GGAEFTTACDFRLMTPESKI RFVHKEMGII PSWGGTTRLV EIIGSRQALK VLSGALKLDS KNALNIGMVE EVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSG RELYLEEALQ NERDLLGTVW GGPANLEAIA KKGKFNK
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Pathways: Fatty Acid Biosynthesis
Gene Name: ECHDC1 enoyl CoA hydratasedomain containing 1 [ Homo sapiens ]
Official Symbol: ECHDC1
Synonyms: ECHDC1; enoyl CoA hydratase domaincontaining 1; dJ351K20.2; enoyl-CoA hydratase domain-containing protein 1;enoyl Coenzyme A hydratase domain containing 1
Gene ID: 55862
mRNA Refseq: NM_001139510
Protein Refseq: NP_001132982
MIM: 612136
UniProt ID: Q9NTX5
Chromosome Location: 6q22.33
Function: catalytic activity; isomerase activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.