"ECHDC1" Related Products

Expand

Recombinant Human Enoyl CoA Hydratase Domain Containing 1, His-tagged

Cat. No.: ECHDC1-1924H
Product Overview: Recombinant humanECHDC1 protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description: ECHDC1,also known as enoyl CoA hydratase domain containing 1, belongs to theenoyl-CoA hydratase/isomerase family. Enoyl-CoA hydratase is an enzyme thathydrates the double bond between the second and third carbons on acyl-CoA.This enzyme is essential to metabolizing fatty acids to produce both acetylCoA and energy.
Form: Liquid. 20mMTris-HCl buffer (pH8.0) containing 10% glycerol 1mM DTT, 0.1M NaCl.
Molecular Weight: 35.8kDa(327aa) confirmed by MALDI-TOF.
Purity: > 95%by SDS-PAGE
Concentration: 1.0mg/ml (determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MALKQEMAKS LLKTASLSGR TKLLHQTGLS LYSTSHGFYE EEVKKTLQQFPGGSIDLQKE DNGIGILTLN NPSRMNAFSG VMMLQLLEKV IELENWTEGKGLIVRGAKNT FSSGSDLNAV KSLGTPEDGM AVCMFMQNTL TRFMRLPLIS VALVQGWALG GGAEFTTACDFRLMTPESKI RFVHKEMGII PSWGGTTRLV EIIGSRQALK VLSGALKLDS KNALNIGMVE EVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSG RELYLEEALQ NERDLLGTVW GGPANLEAIA KKGKFNK
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Pathways: Fatty Acid Biosynthesis
Gene Name: ECHDC1 enoyl CoA hydratasedomain containing 1 [ Homo sapiens ]
Official Symbol: ECHDC1
Synonyms: ECHDC1; enoyl CoA hydratase domaincontaining 1; dJ351K20.2; enoyl-CoA hydratase domain-containing protein 1;enoyl Coenzyme A hydratase domain containing 1
Gene ID: 55862
mRNA Refseq: NM_001139510
Protein Refseq: NP_001132982
MIM: 612136
UniProt ID: Q9NTX5
Chromosome Location: 6q22.33
Function: catalytic activity; isomerase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.