Recombinant Human ECHDC1 Protein, GST-tagged
Cat.No. : | ECHDC1-3032H |
Product Overview : | Human ECHDC1 full-length ORF ( AAH03549.1, 1 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ECHDC1 (Ethylmalonyl-CoA Decarboxylase 1) is a Protein Coding gene. Among its related pathways are Fatty Acid Biosynthesis (WikiPathways) and Propanoate metabolism. GO annotations related to this gene include carboxy-lyase activity and methylmalonyl-CoA decarboxylase activity. |
Molecular Mass : | 59.4 kDa |
AA Sequence : | MAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAKKGKFNK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ECHDC1 enoyl CoA hydratase domain containing 1 [ Homo sapiens ] |
Official Symbol | ECHDC1 |
Synonyms | ECHDC1; enoyl CoA hydratase domain containing 1; enoyl Coenzyme A hydratase domain containing 1; ethylmalonyl-CoA decarboxylase; dJ351K20.2; methylmalonyl-CoA decarboxylase; enoyl-CoA hydratase domain-containing protein 1; MMCD; FLJ40827; DKFZp762M1110; |
Gene ID | 55862 |
mRNA Refseq | NM_001002030 |
Protein Refseq | NP_001002030 |
MIM | 612136 |
UniProt ID | Q9NTX5 |
◆ Recombinant Proteins | ||
ECHDC1-1659R | Recombinant Rat ECHDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ECHDC1-1373R | Recombinant Rhesus monkey ECHDC1 Protein, His-tagged | +Inquiry |
ECHDC1-2749Z | Recombinant Zebrafish ECHDC1 | +Inquiry |
ECHDC1-3032H | Recombinant Human ECHDC1 Protein, GST-tagged | +Inquiry |
ECHDC1-4966M | Recombinant Mouse ECHDC1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECHDC1-526HCL | Recombinant Human ECHDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ECHDC1 Products
Required fields are marked with *
My Review for All ECHDC1 Products
Required fields are marked with *
0
Inquiry Basket