Recombinant Human ELF3

• Cat.No.: ELF3-27972TH
• Product Overview: Recombinant fragment of Human ESE1 with N terminal proprietary tag, 37.73kDa inclusive of tag.

Specification

• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed exclusively in tissues containing a high content of terminally differentiated epithelial cells including mammary gland, colon, trachea, kidney, prostate, uterus, stomach and skin.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEG VFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREI LERVDGRRLVYKFGKNSSGWKEEEVLQSRN
• Sequence Similarities: Belongs to the ETS family.Contains 1 ETS DNA-binding domain.Contains 1 PNT (pointed) domain.

Gene Information

• Gene Name: ELF3 E74-like factor 3 (ets domain transcription factor, epithelial-specific ) [ Homo sapiens ]
• Official Symbol: ELF3
• Synonyms: ELF3; E74-like factor 3 (ets domain transcription factor, epithelial-specific ); ESX; ETS-related transcription factor Elf-3; EPR 1; ERT; ESE 1
• Gene ID: 1999
• mRNA Refseq: NM_001114309
• Protein Refseq: NP_001107781
• MIM: 602191
• Uniprot ID: P78545
• Chromosome Location: 1q32.2
• Pathway: EGFR1 Signaling Pathway, organism-specific biosystem
• Function: protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity