Recombinant Human ELF3 protein, His-tagged
Cat.No. : | ELF3-4014H |
Product Overview : | Recombinant Human ELF3 protein(263-371 aa), fused to His tag, was expressed in E. coli. |
Availability | August 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 263-371 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ELF3 E74-like factor 3 (ets domain transcription factor, epithelial-specific ) [ Homo sapiens ] |
Official Symbol | ELF3 |
Synonyms | ELF3; E74-like factor 3 (ets domain transcription factor, epithelial-specific ); ESX; ETS-related transcription factor Elf-3; EPR 1; ERT; ESE 1; epithelial-restricted with serine box; epithelium-restricted Ets protein ESX; epithelium-specific Ets transcription factor 1; E74-like factor 3 (ets domain transcription factor); ets domain transcription factor, serine box (epithelial-specific); E74-like factor 3 (ETS domain transcription factor, serine box, epithelial-specific); EPR-1; ESE-1; |
Gene ID | 1999 |
mRNA Refseq | NM_001114309 |
Protein Refseq | NP_001107781 |
MIM | 602191 |
UniProt ID | P78545 |
◆ Recombinant Proteins | ||
ELF3-5212H | Recombinant Human ELF3 protein | +Inquiry |
ELF3-2074R | Recombinant Rat ELF3 Protein | +Inquiry |
ELF3-3240H | Recombinant Human ELF3 Protein, GST-tagged | +Inquiry |
ELF3-5213H | Recombinant Human ELF3 protein | +Inquiry |
ELF3-2734M | Recombinant Mouse ELF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELF3-6632HCL | Recombinant Human ELF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELF3 Products
Required fields are marked with *
My Review for All ELF3 Products
Required fields are marked with *