"GPX7" Related Products

Expand
Expand
Expand

Recombinant Human GPX7, FLAG-tagged

Cat.No.: GPX7-29078TH
Product Overview: Recombinant full length Human Glutathione Peroxidase 7 with a C terminal DDDDK tag; mwt: 22 kDa by SDS PAGE.
Protein length: 187 amino acids
Conjugation: FLAG
Molecular Weight: 22.000kDa inclusive of tags
Source: HEK 293 cells
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: PBS, pH 7.2
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
Sequence Similarities: Belongs to the glutathione peroxidase family.
Gene Name: GPX7 glutathione peroxidase 7 [ Homo sapiens ]
Official Symbol: GPX7
Synonyms: GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx;
Gene ID: 2882
mRNA Refseq: NM_015696
Protein Refseq: NP_056511
Uniprot ID: Q96SL4
Chromosome Location: 1p32
Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; glutathione redox reactions I, organism-specific biosystem;
Function: glutathione peroxidase activity; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.