Recombinant Human GPX7 Protein, GST-tagged

Cat.No. : GPX7-5314H
Product Overview : Human GPX7 full-length ORF ( NP_056511.2, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GPX7 (Glutathione Peroxidase 7) is a Protein Coding gene. Diseases associated with GPX7 include Childhood Kidney Cell Carcinoma. Among its related pathways are Glutathione metabolism and Cellular Senescence. GO annotations related to this gene include oxidoreductase activity and peroxidase activity. An important paralog of this gene is GPX8.
Molecular Mass : 47.4 kDa
AA Sequence : MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPX7 glutathione peroxidase 7 [ Homo sapiens ]
Official Symbol GPX7
Synonyms GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx; glutathione peroxidase 6; non-selenocysteine containing phospholipid hydroperoxide glutathione peroxidase; CL683; GPx-7; GSHPx-7;
Gene ID 2882
mRNA Refseq NM_015696
Protein Refseq NP_056511
MIM 615784
UniProt ID Q96SL4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPX7 Products

Required fields are marked with *

My Review for All GPX7 Products

Required fields are marked with *

0
cart-icon
0
compare icon