"NOTCH1" Related Products

Expand
Expand
Expand

Recombinant Human NOTCH1

Cat.No.: NOTCH1-29727TH
Product Overview: Recombinant fragment of Human Notch1 with proprietary tag at the N terminal; Predicted MW 37.73 kDa, inclusive of tag.
Description: This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: In fetal tissues most abundant in spleen, brain stem and lung. Also present in most adult tissues where it is found mainly in lymphoid tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNP CLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPL DNACLTNPCRNGGTCDLLTLTEYKCRCPPG
Sequence Similarities: Belongs to the NOTCH family.Contains 5 ANK repeats.Contains 36 EGF-like domains.Contains 3 LNR (Lin/Notch) repeats.
Gene Name: NOTCH1 notch 1 [ Homo sapiens ]
Official Symbol: NOTCH1
Synonyms: NOTCH1; notch 1; Notch (Drosophila) homolog 1 (translocation associated) , Notch homolog 1, translocation associated (Drosophila) , TAN1; neurogenic locus notch homolog protein 1;
Gene ID: 4851
mRNA Refseq: NM_017617
Protein Refseq: NP_060087
MIM: 190198
Uniprot ID: P46531
Chromosome Location: 9q34.3
Pathway: A third proteolytic cleavage releases NICD, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Dorso-ventral axis formation, organism-specific biosystem; Dorso-ventral axis formation, conserved biosystem;
Function: calcium ion binding; chromatin DNA binding; core promoter binding; protein binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.