| Description : |
This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development. |
| Protein length : |
110 amino acids |
| Molecular Weight : |
37.730kDa inclusive of tags |
| Source : |
Wheat germ |
| Tissue specificity : |
In fetal tissues most abundant in spleen, brain stem and lung. Also present in most adult tissues where it is found mainly in lymphoid tissues. |
| Form : |
Liquid |
| Purity : |
Proprietary Purification |
| Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNP CLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPL DNACLTNPCRNGGTCDLLTLTEYKCRCPPG |
| Sequence Similarities : |
Belongs to the NOTCH family.Contains 5 ANK repeats.Contains 36 EGF-like domains.Contains 3 LNR (Lin/Notch) repeats. |
