Recombinant Human NOTCH1 Protein, GST-tagged
Cat.No. : | NOTCH1-5996H |
Product Overview : | Human NOTCH1 partial ORF ( NP_060087, 23 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOTCH1 notch 1 [ Homo sapiens ] |
Official Symbol | NOTCH1 |
Synonyms | NOTCH1; notch 1; Notch (Drosophila) homolog 1 (translocation associated) , Notch homolog 1, translocation associated (Drosophila) , TAN1; neurogenic locus notch homolog protein 1; Notch homolog 1, translocation-associated; translocation-associated notch protein TAN-1; hN1; TAN1; |
Gene ID | 4851 |
mRNA Refseq | NM_017617 |
Protein Refseq | NP_060087 |
MIM | 190198 |
UniProt ID | P46531 |
◆ Recombinant Proteins | ||
NOTCH1-884M | Active Recombinant Mouse NOTCH1 Protein, His-tagged | +Inquiry |
Notch1-435M | Recombinant Mouse Notch1, Fc-tagged | +Inquiry |
NOTCH1-385H | Recombinant Human NOTCH1 protein, His-tagged | +Inquiry |
NOTCH1-2498H | Recombinant Human NOTCH1 Protein, His-tagged | +Inquiry |
NOTCH1-531HB | Recombinant Human NOTCH1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOTCH1-469MCL | Recombinant Mouse NOTCH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOTCH1 Products
Required fields are marked with *
My Review for All NOTCH1 Products
Required fields are marked with *
0
Inquiry Basket