"NOVA1" Related Products

Expand
Expand

Recombinant Human NOVA1

Cat.No.: NOVA1-29728TH
Product Overview: Recombinant full length Human Nova1 with N terminal proprietary tag, predicted mwt: 81.51 kDa.
Description: This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described.
Protein length: 508 amino acids
Molecular Weight: 81.510kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Brain.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTK RTNTGEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETG ATIKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKI REMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKS SPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQ SGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELIIQK IQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLP TAAAAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALN TLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAAAAN LLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFG AASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKG GKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAA TQAAQYLITQRITYEQGVRAANPQKVG
Sequence Similarities: Contains 3 KH domains.
Gene Name: NOVA1 neuro-oncological ventral antigen 1 [ Homo sapiens ]
Official Symbol: NOVA1
Synonyms: NOVA1; neuro-oncological ventral antigen 1; RNA-binding protein Nova-1;
Gene ID: 4857
mRNA Refseq: NM_002515
Protein Refseq: NP_002506
MIM: 602157
Uniprot ID: P51513
Chromosome Location: 14q12
Function: RNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.