"NTRK1" Related Products

Expand
Expand

Recombinant Human NTRK1, Fc-tagged

Cat.No.: NTRK1-31619TH
Product Overview: Recombinant fragment corresponding to amino acids 33-405 of Human TrkA fused to the Fc region of human IgG1 expressed in modified human 293 cells.
Description: This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, mental retardation and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date.
Conjugation: Fc
Tissue specificity: Isoform TrkA-II is primarily expressed in neuronal cells; isoform TrkA-I is found in non-neuronal tissues.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Shipped at 4°C. After reconstitution store at -20oC. Avoid freeze / thaw cycles.
Sequences of amino acids: Theoretical sequence:AAPCPDACCPHGSSGLRCTRDGALDSLHH LPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIV KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQG LSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKL QCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRC QVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLAN VTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLH TAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIF TEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPF GQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSE IPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCRV SNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK
Sequence Similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 2 LRR (leucine-rich) repeats.Contains 1 LRRCT domain.Contains 1 protein kinase domain.
Gene Name: NTRK1 neurotrophic tyrosine kinase, receptor, type 1 [ Homo sapiens ]
Official Symbol: NTRK1
Synonyms: NTRK1; neurotrophic tyrosine kinase, receptor, type 1; high affinity nerve growth factor receptor; MTC; TRK; TRKA;
Gene ID: 4914
mRNA Refseq: NM_001007792
Protein Refseq: NP_001007793
MIM: 191315
Uniprot ID: P04629
Chromosome Location: 1q21-q22
Pathway: ARMS-mediated activation, organism-specific biosystem; Activation of TRKA receptors, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Endocytosis, organism-specific biosystem;
Function: ATP binding; neurotrophin binding; nucleotide binding; receptor activity; transmembrane receptor protein tyrosine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.