"STX2" Related Products

Expand
Expand
Expand

Recombinant Human STX2

Cat.No.: STX2-30658TH
Product Overview: Recombinant full length Human Syntaxin 2 Isoform 1 with N-Terminal proprietary tag.Mol Wt 57.64 kDa inclusive of tag.
Description: The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein length: 287 amino acids
Molecular Weight: 57.640kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIR NSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKE IKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHS VLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTT DDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKD IMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNAT DYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGI ILATTLS
Sequence Similarities: Belongs to the syntaxin family.Contains 1 t-SNARE coiled-coil homology domain.
Gene Name: STX2 syntaxin 2 [ Homo sapiens ]
Official Symbol: STX2
Synonyms: STX2; syntaxin 2; EPIM, epimorphin , STX2A, STX2B, STX2C; syntaxin-2; EPM;
Gene ID: 2054
mRNA Refseq: NM_001980
Protein Refseq: NP_001971
MIM: 132350
Uniprot ID: P32856
Chromosome Location: 12q24
Pathway: Botulinum neurotoxicity, organism-specific biosystem; Neuronal System, organism-specific biosystem; Proteolytic cleavage of SNARE complex proteins, organism-specific biosystem; SNARE interactions in vesicular transport, organism-specific biosystem; SNARE interactions in vesicular transport, conserved biosystem;
Function: SNAP receptor activity; SNARE binding; calcium-dependent protein binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.