Recombinant Human STX2 Protein, GST-tagged
Cat.No. : | STX2-4046H |
Product Overview : | Human EPIM full-length ORF ( NP_001971.2, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 59.7 kDa |
AA Sequence : | MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGIILATTLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | STX2 syntaxin 2 [ Homo sapiens ] |
Official Symbol | STX2 |
Synonyms | STX2; syntaxin 2; EPIM, epimorphin , STX2A, STX2B, STX2C; syntaxin-2; EPM; epimorphin; EPIM; STX2A; STX2B; STX2C; MGC51014; |
Gene ID | 2054 |
mRNA Refseq | NM_194356 |
Protein Refseq | NP_919337 |
MIM | 132350 |
UniProt ID | P32856 |
◆ Recombinant Proteins | ||
STX2-5749H | Recombinant Human STX2 Protein (Met1-Arg188), N-His tagged | +Inquiry |
STX2-4046H | Recombinant Human STX2 Protein, GST-tagged | +Inquiry |
STX2-30658TH | Recombinant Human STX2 | +Inquiry |
STX2-5813R | Recombinant Rat STX2 Protein | +Inquiry |
STX2-2990H | Recombinant Human STX2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX2-1718HCL | Recombinant Human STX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STX2 Products
Required fields are marked with *
My Review for All STX2 Products
Required fields are marked with *