Recombinant Human STX2 Protein, GST-tagged

Cat.No. : STX2-4046H
Product Overview : Human EPIM full-length ORF ( NP_001971.2, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Molecular Mass : 59.7 kDa
AA Sequence : MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGIILATTLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name STX2 syntaxin 2 [ Homo sapiens ]
Official Symbol STX2
Synonyms STX2; syntaxin 2; EPIM, epimorphin , STX2A, STX2B, STX2C; syntaxin-2; EPM; epimorphin; EPIM; STX2A; STX2B; STX2C; MGC51014;
Gene ID 2054
mRNA Refseq NM_194356
Protein Refseq NP_919337
MIM 132350
UniProt ID P32856

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STX2 Products

Required fields are marked with *

My Review for All STX2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon