Recombinant Human TNPO1
Cat.No. : | TNPO1-31605TH |
Product Overview : | Recombinant fragment of Human Transportin 1 with a N terminal proprietary tag: predicted molecular weight 38.50 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes the beta subunit of the karyopherin receptor complex which interacts with nuclear localization signals to target nuclear proteins to the nucleus. The karyopherin receptor complex is a heterodimer of an alpha subunit which recognizes the nuclear localization signal and a beta subunit which docks the complex at nucleoporins. Alternate splicing of this gene results in two transcript variants encoding different proteins. |
Protein length : | 117 amino acids |
Molecular Weight : | 38.500kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPT RSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSP LIRATVGILITTIASKGELQNWPDLLPKLCSLLDSED* |
Gene Name : | TNPO1 transportin 1 [ Homo sapiens ] |
Official Symbol : | TNPO1 |
Synonyms : | TNPO1; transportin 1; karyopherin (importin) beta 2 , KPNB2; transportin-1; importin 2; IPO2; MIP; MIP1; TRN; |
Gene ID : | 3842 |
mRNA Refseq : | NM_002270 |
Protein Refseq : | NP_002261 |
MIM : | 602901 |
Uniprot ID : | Q92973 |
Chromosome Location : | 5q13.1 |
Pathway : | Destabilization of mRNA by Tristetraprolin (TTP), organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem; |
Function : | nuclear localization sequence binding; protein binding; protein transporter activity; |
Products Types
◆ Recombinant Protein | ||
TNPO1-9503M | Recombinant Mouse TNPO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNPO1-17203M | Recombinant Mouse TNPO1 Protein | +Inquiry |
Tnpo1-343M | Recombinant Mouse Tnpo1 Protein, His-tagged | +Inquiry |
TNPO1-342H | Recombinant Human TNPO1 Protein, His-tagged | +Inquiry |
TNPO1-341C | Recombinant Cattle TNPO1 Protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All TNPO1 Products
Required fields are marked with *
My Review for All TNPO1 Products
Required fields are marked with *
0
Inquiry Basket