Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human TNPO1

Cat.No. : TNPO1-31605TH
Product Overview : Recombinant fragment of Human Transportin 1 with a N terminal proprietary tag: predicted molecular weight 38.50 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes the beta subunit of the karyopherin receptor complex which interacts with nuclear localization signals to target nuclear proteins to the nucleus. The karyopherin receptor complex is a heterodimer of an alpha subunit which recognizes the nuclear localization signal and a beta subunit which docks the complex at nucleoporins. Alternate splicing of this gene results in two transcript variants encoding different proteins.
Protein length : 117 amino acids
Molecular Weight : 38.500kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPT RSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSP LIRATVGILITTIASKGELQNWPDLLPKLCSLLDSED*
Gene Name : TNPO1 transportin 1 [ Homo sapiens ]
Official Symbol : TNPO1
Synonyms : TNPO1; transportin 1; karyopherin (importin) beta 2 , KPNB2; transportin-1; importin 2; IPO2; MIP; MIP1; TRN;
Gene ID : 3842
mRNA Refseq : NM_002270
Protein Refseq : NP_002261
MIM : 602901
Uniprot ID : Q92973
Chromosome Location : 5q13.1
Pathway : Destabilization of mRNA by Tristetraprolin (TTP), organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem;
Function : nuclear localization sequence binding; protein binding; protein transporter activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All TNPO1 Products

Required fields are marked with *

My Review for All TNPO1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends