Recombinant Human TSC22D1, His-tagged
| Cat.No. : | TSC22D1-30748TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 40-144 of Human TSC22D1 Isoform 2 with an N terminal His tag; Predicted MWt 12 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 40-144 a.a. |
| Description : | This gene encodes a member of the TSC22 domain family of leucine zipper transcription factors. The encoded protein is stimulated by transforming growth factor beta, and regulates the transcription of multiple genes including C-type natriuretic peptide. The encoded protein may play a critical role in tumor suppression through the induction of cancer cell apoptosis, and a single nucleotide polymorphism in the promoter of this gene has been associated with diabetic nephropathy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 139 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKE QIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTG SPPATTQPQGTTQPPAQPASQGSGPTA |
| Gene Name | TSC22D1 TSC22 domain family, member 1 [ Homo sapiens ] |
| Official Symbol | TSC22D1 |
| Synonyms | TSC22D1; TSC22 domain family, member 1; TGFB1I4, transforming growth factor beta 1 induced transcript 4; TSC22 domain family protein 1; MGC17597; TSC22; |
| Gene ID | 8848 |
| mRNA Refseq | NM_001243798 |
| Protein Refseq | NP_001230727 |
| MIM | 607715 |
| Uniprot ID | Q15714 |
| Chromosome Location | 13q14 |
| Function | sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| TSC22D1-1996C | Recombinant Chicken TSC22D1 | +Inquiry |
| TSC22D1-30748TH | Recombinant Human TSC22D1, His-tagged | +Inquiry |
| TSC22D1-12015Z | Recombinant Zebrafish TSC22D1 | +Inquiry |
| Tsc22d1-999M | Recombinant Mouse Tsc22d1 protein, His-tagged | +Inquiry |
| TSC22D1-6668C | Recombinant Chicken TSC22D1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TSC22D1-724HCL | Recombinant Human TSC22D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSC22D1 Products
Required fields are marked with *
My Review for All TSC22D1 Products
Required fields are marked with *




