Recombinant Human TSC22D1, His-tagged
Cat.No. : | TSC22D1-30748TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 40-144 of Human TSC22D1 Isoform 2 with an N terminal His tag; Predicted MWt 12 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the TSC22 domain family of leucine zipper transcription factors. The encoded protein is stimulated by transforming growth factor beta, and regulates the transcription of multiple genes including C-type natriuretic peptide. The encoded protein may play a critical role in tumor suppression through the induction of cancer cell apoptosis, and a single nucleotide polymorphism in the promoter of this gene has been associated with diabetic nephropathy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 139 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKE QIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTG SPPATTQPQGTTQPPAQPASQGSGPTA |
Gene Name : | TSC22D1 TSC22 domain family, member 1 [ Homo sapiens ] |
Official Symbol : | TSC22D1 |
Synonyms : | TSC22D1; TSC22 domain family, member 1; TGFB1I4, transforming growth factor beta 1 induced transcript 4; TSC22 domain family protein 1; MGC17597; TSC22; |
Gene ID : | 8848 |
mRNA Refseq : | NM_001243798 |
Protein Refseq : | NP_001230727 |
MIM : | 607715 |
Uniprot ID : | Q15714 |
Chromosome Location : | 13q14 |
Function : | sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
TSC22D1-877H | Recombinant Human TSC22D1 protein, His-tagged | +Inquiry |
TSC22D1-1996C | Recombinant Chicken TSC22D1 | +Inquiry |
TSC22D1-6668C | Recombinant Chicken TSC22D1 | +Inquiry |
TSC22D1-3442H | Recombinant Human TSC22D1, GST-tagged | +Inquiry |
TSC22D1-12015Z | Recombinant Zebrafish TSC22D1 | +Inquiry |
◆ Lysates | ||
TSC22D1-724HCL | Recombinant Human TSC22D1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket