Native Human TGFA

• Cat.No.: TGFA-29704TH
• Product Overview: Human TGF alpha.

Specification

• Description: This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Source: E. coli
• Tissue specificity: Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
• Form: Liquid
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: Recombinant Human TGF-a is a 5.5 kDa protein containing 50 amino acid residues:VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHA DLLA
• Sequence Similarities: Contains 1 EGF-like domain.

Gene Information

• Gene Name: TGFA transforming growth factor, alpha [ Homo sapiens ]
• Official Symbol: TGFA
• Synonyms: TGFA; transforming growth factor, alpha; protransforming growth factor alpha
• Gene ID: 7039
• mRNA Refseq: NM_001099691
• Protein Refseq: NP_001093161
• MIM: 190170
• Uniprot ID: P01135
• Chromosome Location: 2p13
• Pathway: Direct p53 effectors, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem
• Function: MAP kinase kinase activity; epidermal growth factor receptor binding; glycoprotein binding; growth factor activity; protein binding