Active Recombinant Human TGFA Protein
| Cat.No. : | TGFA-205T |
| Product Overview : | Recombinant Human TGFA Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Description : | Protransforming Growth Factor-alpha (TGF-alpha), also known as sarcoma growth factor, TGF-type I and ETGF, is a member of the EGF family of cytokines. It is expressed in monocytes, brain cells, keratinocytes and various tumor cells. ProTGF-alpha signals through EGFR and acts synergistically with TGF-beta to promote the proliferation of a wide range of epidermal and epithelial cells. It may function as either a membrane-bound ligand or a soluble ligand. Membrane-bound proTGF-alpha plays a role in cell-cell adhesion and juxtacrine stimulation of adjacent cells. The soluble form of the cytokine is released from the membrane-bound form by proteolytic cleavage and acts as a mitogen for cell proliferation. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 0.4 ng/mL, measured in a cell proliferation assay using 3T3 cells. |
| Molecular Mass : | 8-10 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
| Storage : | Lyophilized recombinant Human TGF-alpha remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human TGF-alpha Receptor should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | TGFA transforming growth factor alpha [ Homo sapiens (human) ] |
| Official Symbol | TGFA |
| Synonyms | TGFA; transforming growth factor alpha; protransforming growth factor alpha; TGF-alpha |
| Gene ID | 7039 |
| mRNA Refseq | NM_003236 |
| Protein Refseq | NP_003227 |
| MIM | 190170 |
| UniProt ID | P01135 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFA Products
Required fields are marked with *
My Review for All TGFA Products
Required fields are marked with *



