Active Recombinant Human TGFA Protein

Cat.No. : TGFA-205T
Product Overview : Recombinant Human TGFA Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : Protransforming Growth Factor-alpha (TGF-alpha), also known as sarcoma growth factor, TGF-type I and ETGF, is a member of the EGF family of cytokines. It is expressed in monocytes, brain cells, keratinocytes and various tumor cells. ProTGF-alpha signals through EGFR and acts synergistically with TGF-beta to promote the proliferation of a wide range of epidermal and epithelial cells. It may function as either a membrane-bound ligand or a soluble ligand. Membrane-bound proTGF-alpha plays a role in cell-cell adhesion and juxtacrine stimulation of adjacent cells. The soluble form of the cytokine is released from the membrane-bound form by proteolytic cleavage and acts as a mitogen for cell proliferation.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.4 ng/mL, measured in a cell proliferation assay using 3T3 cells.
Molecular Mass : 8-10 kDa, observed by reducing SDS-PAGE.
AA Sequence : VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Human TGF-alpha remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human TGF-alpha Receptor should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name TGFA transforming growth factor alpha [ Homo sapiens (human) ]
Official Symbol TGFA
Synonyms TGFA; transforming growth factor alpha; protransforming growth factor alpha; TGF-alpha
Gene ID 7039
mRNA Refseq NM_003236
Protein Refseq NP_003227
MIM 190170
UniProt ID P01135

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TGFA Products

Required fields are marked with *

My Review for All TGFA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon