Active Recombinant Human TGFA Protein

Cat.No. : TGFA-244H
Product Overview : Recombinant Human TGFA Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Tumor growth factor alpha (TGF-α) is a member of the epidermal growth factor (EGF) family. TGF-α function is mediated through binding the EGF receptor (EGFR) to activate receptor tyrosine kinase signaling. TGF-α functions as a mitogen to activate epithelial cell proliferation, growth, and differentiation. In the gastric mucosa, TGF-α production inhibits gastric acid secretion and therefore plays a central role in the pathogenesis of the stomach syndrome Ménétrier’s disease. TGF-α is also produced in adult macrophages, brain cells, keratinocytes, and is widely expressed in cancer cells.
Bio-activity : 3T3 cell proliferation, ED50≤2 ng/mL
Molecular Mass : Monomer, 5.6 kDa (with 50 amino acids)
AA Sequence : VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Endotoxin : ≤1 EUs/μg, Kinetic LAL (50% confidence)
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name TGFA transforming growth factor, alpha [ Homo sapiens (human) ]
Official Symbol TGFA
Synonyms TGFA; transforming growth factor, alpha; protransforming growth factor alpha; TGF-alpha; TFGA;
Gene ID 7039
mRNA Refseq NM_001099691
Protein Refseq NP_001093161
MIM 190170
UniProt ID P01135

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TGFA Products

Required fields are marked with *

My Review for All TGFA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon