"POU5F1" Related Products

Expand

Recombinant Human POU5F1 protein

Cat.No.: POU5F1-113H
Product Overview: Recombinant human POU5F1 fused with C-terminal tag of 11 arginine domain, which efficiently delivery protein intracellularly was expressed in E. coli. To further increase Oct4 activity for gene transcription activation, HSV VP16 TAD (transcription activat
Source: E. coli
Species: Human
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Bio-activity: DNA binding assay: DNA binding activity was demonstrated using Oct4 specific DNA binding oligo derived EMSA.
AA Sequence: MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAY CGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFA KLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAET LVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA AGSPFSGGPVSFLLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSNTSRSEPSGPISTGNP SPPSKESHKSPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGFTPHDSAPYGALDMADFEFEQMF TDALGIDEYGGLEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for protein derived iPS generation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.
Storage: Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: POU5F1 POU class 5 homeobox 1 [ Homo sapiens ]
Official Symbol: POU5F1
Synonyms: POU5F1; POU class 5 homeobox 1; OTF3, POU domain class 5, transcription factor 1; POU domain, class 5, transcription factor 1; MGC22487; OCT3; Oct4; octamer-binding protein 3; octamer-binding protein 4; POU domain transcription factor OCT4; octamer-bindi
Gene ID: 5460
mRNA Refseq: NM_001173531
Protein Refseq: NP_001167002
MIM: 164177
UniProt ID: Q01860
Chromosome Location: 6p21.33
Pathway: HIF-2-alpha transcription factor network, organism-specific biosystem; Wnt Signaling Pathway and Pluripotency, organism-specific biosystem;
Function: DNA binding; miRNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding RNA polymerase II transcription factor activity; sequence-specific DNA binding transcription factor activity; transcription factor binding; transcrip

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.