"WNT8A" Related Products

Expand
Expand
Expand

Recombinant Human WNT8A, StrepII-tagged

Cat.No.: WNT8A-209H
Product Overview: Purified, full-length human recombinant WNT8A protein (amino acids 25-351, 327 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 36.3 kDa. (Accession NP_490645.1; UniProt Q9H1J5)
Description: The WNT family consists of structurally related signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This protein is a member of the WNT family, and may be implicated in development of early embryos as well as germ cell tumors. It may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 25-351, 327 a.a.
AA Sequence: VNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYI ITKNCSMGDFENCGCDGSNNGKTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRA TMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAEL IFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKC DQCRHVVSKYYCARSPGSAQSLGKGSA
Endotoxin: <0.1 eu per ug protein by lal method
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: WNT8A wingless-type MMTV integration site family, member 8A [ Homo sapiens ]
Official Symbol: WNT8A
Synonyms: WNT8A; wingless-type MMTV integration site family, member 8A; protein Wnt-8a; WNT8D; WNT8d; protein Wnt-8d;
Gene ID: 7478
mRNA Refseq: NM_058244
Protein Refseq: NP_490645
MIM: 606360
UniProt ID: Q9H1J5
Chromosome Location: 5q31
Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Hedgehog signaling pathway, organism-specific biosystem;
Function: G-protein coupled receptor binding; frizzled binding; receptor agonist activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.