"WNT11" Related Products

Expand
Expand
Expand

Recombinant Human WNT11, StrepII-tagged

Cat.No.: WNT11-242H
Product Overview: Purified, full-length human recombinant WNT11 protein (amino acids 25-354, 330 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 36.6 kDa. (Accession NP_004617.2; UniProt O96014)
Description: The WNT family consists of structurally related signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This protein is a member of the WNT family. This proein may play roles in the development of skeleton, kidney and lung, and is considered to be a plausible candidate gene for High Bone Mass Syndrome.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 25-354, 330 a.a.
AA Sequence: IKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFV YALSAAAISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCKC HGVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSC DLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
Endotoxin: <0.1 eu per ug protein by lal
Purity: >80% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: WNT11 wingless-type MMTV integration site family, member 11 [ Homo sapiens ]
Official Symbol: WNT11
Synonyms: HWNT11
Gene ID: 7481
mRNA Refseq: NM_004626.2
Protein Refseq: NP_004617.2
MIM: 603699
UniProt ID: O96014
Chromosome Location: 11q13.5
Pathway: Basal cell carcinoma, organism-specific biosystem;Basal cell carcinoma, conserved biosystem;Class B/2 (Secretin family receptors), organism-specific biosystem;DNA damage response (only ATM dependent), organism-specific biosystem;GPCR ligand binding, organism-specific biosystem;HTLV-I infection, organism-specific biosystem;HTLV-I infection, conserved biosystem;
Function: G-protein coupled receptor binding;Ras GTPase activator activity;protein kinase activator activity;transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.