Recombinant Human GNB5, His-tagged
Cat.No. : | GNB5-29091TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-353 of Human GNB5 isoform 2, with a N terminal His tag; MWt 46kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Description : | Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Alternatively spliced transcript variants encoding different isoforms exist. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Expressed in multiple tissues. |
Form : | Lyophilised:Reconstitution with 112 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQ VAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRI VSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPS GCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYL SACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGH GADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCV QAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRA DREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVW DVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHT LRVWA |
Sequence Similarities : | Belongs to the WD repeat G protein beta family.Contains 7 WD repeats. |
Gene Name : | GNB5 guanine nucleotide binding protein (G protein), beta 5 [ Homo sapiens ] |
Official Symbol : | GNB5 |
Synonyms : | GNB5; guanine nucleotide binding protein (G protein), beta 5; guanine nucleotide-binding protein subunit beta-5; GB5; |
Gene ID : | 10681 |
mRNA Refseq : | NM_006578 |
Protein Refseq : | NP_006569 |
MIM : | 604447 |
Uniprot ID : | O14775 |
Chromosome Location : | 15q21.1 |
Pathway : | ADP signalling through P2Y purinoceptor 1, organism-specific biosystem; ADP signalling through P2Y purinoceptor 12, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Aquaporin-mediated transport, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; |
Function : | GTPase activity; signal transducer activity; |
Products Types
◆ Recombinant Protein | ||
GNB5-3769M | Recombinant Mouse GNB5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNB5-2259R | Recombinant Rat GNB5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNB5-5058H | Recombinant Human GNB5 Protein, GST-tagged | +Inquiry |
GNB5-7031M | Recombinant Mouse GNB5 Protein | +Inquiry |
GNB5-5563C | Recombinant Chicken GNB5 | +Inquiry |
◆ Lysates | ||
GNB5-5859HCL | Recombinant Human GNB5 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All GNB5 Products
Required fields are marked with *
My Review for All GNB5 Products
Required fields are marked with *
0
Inquiry Basket