Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human HTATIP2, His-tagged

Cat.No. : HTATIP2-30680TH
Product Overview : Recombinant full length Human TIP30 with N terminal His tag; 262 amino acids with a predicted MWt 29.3 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Oxidoreductase HTATIP2 is an enzyme that in humans is encoded by the HTATIP2 gene. It may be a metastasis suppressor.
Protein length : 242 amino acids
Conjugation : HIS
Molecular Weight : 29.300kDa inclusive of tags
Source : E. coli
Tissue specificity : Ubiquitous. Highest level in liver. High levels in lung, skeletal muscle, pancreas and placenta. Moderate levels in heart and kidney. Low levels in brain. Not expressed or low levels in variant small cell lung carcinomas, 33% of hepatocellular carcinomas
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol
Storage : Please see Notes section
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAETEALSKLREDFRMQNKS VFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEE AYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAG AEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSN FLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPG EWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDK QMELLENKAIHDLGKAHGSLKP
Gene Name : HTATIP2 HIV-1 Tat interactive protein 2, 30kDa [ Homo sapiens ]
Official Symbol : HTATIP2
Synonyms : HTATIP2; HIV-1 Tat interactive protein 2, 30kDa; HIV 1 Tat interactive protein 2, 30 kDa; oxidoreductase HTATIP2; CC3; FLJ26963; SDR44U1; short chain dehydrogenase/reductase family 44U; member 1; Tat interacting protein (30kD); TIP30;
Gene ID : 10553
mRNA Refseq : NM_001098523
Protein Refseq : NP_001091993
MIM : 605628
Uniprot ID : Q9BUP3
Chromosome Location : 11p15.1
Function : NAD binding; oxidoreductase activity; oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor; protein binding; transcription coactivator activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All HTATIP2 Products

Required fields are marked with *

My Review for All HTATIP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends