Recombinant Human HTATIP2, His-tagged
Cat.No. : | HTATIP2-30680TH |
Product Overview : | Recombinant full length Human TIP30 with N terminal His tag; 262 amino acids with a predicted MWt 29.3 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Oxidoreductase HTATIP2 is an enzyme that in humans is encoded by the HTATIP2 gene. It may be a metastasis suppressor. |
Protein length : | 242 amino acids |
Conjugation : | HIS |
Molecular Weight : | 29.300kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Ubiquitous. Highest level in liver. High levels in lung, skeletal muscle, pancreas and placenta. Moderate levels in heart and kidney. Low levels in brain. Not expressed or low levels in variant small cell lung carcinomas, 33% of hepatocellular carcinomas |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAETEALSKLREDFRMQNKS VFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEE AYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAG AEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSN FLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPG EWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDK QMELLENKAIHDLGKAHGSLKP |
Gene Name : | HTATIP2 HIV-1 Tat interactive protein 2, 30kDa [ Homo sapiens ] |
Official Symbol : | HTATIP2 |
Synonyms : | HTATIP2; HIV-1 Tat interactive protein 2, 30kDa; HIV 1 Tat interactive protein 2, 30 kDa; oxidoreductase HTATIP2; CC3; FLJ26963; SDR44U1; short chain dehydrogenase/reductase family 44U; member 1; Tat interacting protein (30kD); TIP30; |
Gene ID : | 10553 |
mRNA Refseq : | NM_001098523 |
Protein Refseq : | NP_001091993 |
MIM : | 605628 |
Uniprot ID : | Q9BUP3 |
Chromosome Location : | 11p15.1 |
Function : | NAD binding; oxidoreductase activity; oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor; protein binding; transcription coactivator activity; |
Products Types
◆ Recombinant Protein | ||
HTATIP2-2193H | Recombinant Human HTATIP2 Protein, MYC/DDK-tagged | +Inquiry |
HTATIP2-4371M | Recombinant Mouse HTATIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HTATIP2-5256H | Recombinant Human HTATIP2 Protein, GST-tagged | +Inquiry |
Htatip2-3461M | Recombinant Mouse Htatip2 Protein, Myc/DDK-tagged | +Inquiry |
HTATIP2-2723H | Recombinant Human HIV-1 Tat Interactive Protein 2, 30kDa, His-tagged | +Inquiry |
◆ Lysates | ||
HTATIP2-826HCL | Recombinant Human HTATIP2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All HTATIP2 Products
Required fields are marked with *
My Review for All HTATIP2 Products
Required fields are marked with *
0
Inquiry Basket