Recombinant Human HTATIP2 Protein, GST-tagged

Cat.No. : HTATIP2-5256H
Product Overview : Human HTATIP2 full-length ORF ( AAH02439, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HTATIP2 (HIV-1 Tat Interactive Protein 2) is a Protein Coding gene. Diseases associated with HTATIP2 include Hiv-1 and Gnathodiaphyseal Dysplasia. Among its related pathways are Apoptosis and Autophagy and Cytoskeletal Signaling. GO annotations related to this gene include oxidoreductase activity and NAD binding.
Molecular Mass : 52.36 kDa
AA Sequence : MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HTATIP2 HIV-1 Tat interactive protein 2, 30kDa [ Homo sapiens ]
Official Symbol HTATIP2
Synonyms HTATIP2; HIV-1 Tat interactive protein 2, 30kDa; HIV 1 Tat interactive protein 2, 30 kDa; oxidoreductase HTATIP2; CC3; FLJ26963; SDR44U1; short chain dehydrogenase/reductase family 44U; member 1; Tat interacting protein (30kD); TIP30; Tat-interacting protein (30kD); HIV-1 TAT-interactive protein 2; 30 kDa HIV-1 TAT-interacting protein; short chain dehydrogenase/reductase family 44U, member 1;
Gene ID 10553
mRNA Refseq NM_001098520
Protein Refseq NP_001091990
MIM 605628
UniProt ID Q9BUP3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HTATIP2 Products

Required fields are marked with *

My Review for All HTATIP2 Products

Required fields are marked with *

0
cart-icon