Recombinant Human HTATIP2 Protein, GST-tagged
| Cat.No. : | HTATIP2-5256H |
| Product Overview : | Human HTATIP2 full-length ORF ( AAH02439, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HTATIP2 (HIV-1 Tat Interactive Protein 2) is a Protein Coding gene. Diseases associated with HTATIP2 include Hiv-1 and Gnathodiaphyseal Dysplasia. Among its related pathways are Apoptosis and Autophagy and Cytoskeletal Signaling. GO annotations related to this gene include oxidoreductase activity and NAD binding. |
| Molecular Mass : | 52.36 kDa |
| AA Sequence : | MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HTATIP2 HIV-1 Tat interactive protein 2, 30kDa [ Homo sapiens ] |
| Official Symbol | HTATIP2 |
| Synonyms | HTATIP2; HIV-1 Tat interactive protein 2, 30kDa; HIV 1 Tat interactive protein 2, 30 kDa; oxidoreductase HTATIP2; CC3; FLJ26963; SDR44U1; short chain dehydrogenase/reductase family 44U; member 1; Tat interacting protein (30kD); TIP30; Tat-interacting protein (30kD); HIV-1 TAT-interactive protein 2; 30 kDa HIV-1 TAT-interacting protein; short chain dehydrogenase/reductase family 44U, member 1; |
| Gene ID | 10553 |
| mRNA Refseq | NM_001098520 |
| Protein Refseq | NP_001091990 |
| MIM | 605628 |
| UniProt ID | Q9BUP3 |
| ◆ Recombinant Proteins | ||
| HTATIP2-4371M | Recombinant Mouse HTATIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HTATIP2-5256H | Recombinant Human HTATIP2 Protein, GST-tagged | +Inquiry |
| HTATIP2-30680TH | Recombinant Human HTATIP2, His-tagged | +Inquiry |
| HTATIP2-2723H | Recombinant Human HIV-1 Tat Interactive Protein 2, 30kDa, His-tagged | +Inquiry |
| HTATIP2-9208Z | Recombinant Zebrafish HTATIP2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HTATIP2-826HCL | Recombinant Human HTATIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTATIP2 Products
Required fields are marked with *
My Review for All HTATIP2 Products
Required fields are marked with *



