Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human MRPS10, His-tagged

Cat.No. : MRPS10-28171TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-201 of Human MRPS10 with an N terminal His tag; Predicted MWt 24 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S10P family. Pseudogenes corresponding to this gene are found on chromosomes 1q, 3p, and 9p.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 134 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAARTAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLST NMKWVQFSNLHVDVPKDLTKPVVTISDEPDILYKRLSV LVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIE RFTLLQSVHIYKKHRVQYEMRTLYRCLELEHLTGSTAD VYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSE EKEESKS
Gene Name : MRPS10 mitochondrial ribosomal protein S10 [ Homo sapiens ]
Official Symbol : MRPS10
Synonyms : MRPS10; mitochondrial ribosomal protein S10; 28S ribosomal protein S10, mitochondrial; FLJ10567;
Gene ID : 55173
mRNA Refseq : NM_018141
Protein Refseq : NP_060611
MIM : 611976
Uniprot ID : P82664
Chromosome Location : 6p21.1
Function : molecular_function; structural constituent of ribosome;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All MRPS10 Products

Required fields are marked with *

My Review for All MRPS10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends