"RAB8A" Related Products

Expand
Expand
Expand

Recombinant Human RAB8A

Cat.No.: RAB8A-29054TH
Product Overview: Recombinant full length Human RAB8A with N terminal proprietary tag; predicted MWt 48.77 kDa inclusive of tag; P61006, AAH02977.
Description: The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.
Protein length: 207 amino acids
Molecular Weight: 48.770kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFIST IGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRG AMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVEN AFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSS FFRCVLL
Sequence Similarities: Belongs to the small GTPase superfamily. Rab family.
Gene Name: RAB8A RAB8A, member RAS oncogene family [ Homo sapiens ]
Official Symbol: RAB8A
Synonyms: RAB8A; RAB8A, member RAS oncogene family; MEL, mel transforming oncogene (derived from cell line NK14); ras-related protein Rab-8A; RAB8;
Gene ID: 4218
mRNA Refseq: NM_005370
Protein Refseq: NP_005361
MIM: 165040
Uniprot ID: P61006
Chromosome Location: 19p13.2-p13.1
Pathway: Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem;
Function: GTP binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.