"IFNA1" Related Products

Expand
Expand

Recombinant Human IFNA1, StrepII-tagged

Cat.No.: IFNA1-256H
Product Overview: Purified, full-length human recombinant IFNA1/13 or Interferon alpha-1/13 protein (amino acids 24-189, 166 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 19.4 kDa. (Accession NP_008831.3; UniProt P01562)
Description: IFNA1/13 is produced by macrophages and has antiviral activities. It stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 24-189, 166 a.a.
AA Sequence: CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQ QLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: IFNA1 interferon, alpha 1 [ Homo sapiens ]
Official Symbol: IFNA1
Synonyms: IFNA1; interferon, alpha 1; interferon alpha-1/13; IFL; IFN; IFN ALPHA; IFN alpha 1b; IFN alphaD; IFNA13; IFNA@; interferon alpha 1b; leIF D; IFN-alpha 1b; IFN-alpha-1/13; interferon-alpha1; interferon alpha-D; IFN-ALPHA; IFN-alphaD; MGC138207; MGC138505; MGC138507;
Gene ID: 3439
mRNA Refseq: NM_024013
Protein Refseq: NP_076918
MIM: 147660
UniProt ID: P01562
Chromosome Location: 9p22
Pathway: Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.