Recombinant Human SIX1
| Cat.No. : | SIX1-30869TH |
| Product Overview : | Recombinant full length Human SIX1 with N-terminal proprietary tag, 56.98 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | The protein encoded by this gene is a homeobox protein that is similar to the Drosophila sine oculis gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in limb development. Defects in this gene are a cause of autosomal dominant deafness type 23 (DFNA23) and branchiootic syndrome type 3 (BOS3). |
| Protein length : | 284 amino acids |
| Molecular Weight : | 56.980kDa inclusive of tags |
| Source : | Wheat germ |
| Tissue specificity : | Specifically expressed in skeletal muscle. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPAC DHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNH PKLQQLWLKAHYVEAEKLCGRPLGAVGKYRVRRKFPLPRT IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEA TGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQ NQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLV DLGS |
| Sequence Similarities : | Belongs to the SIX/Sine oculis homeobox family.Contains 1 homeobox DNA-binding domain. |
| Gene Name : | SIX1 SIX homeobox 1 [ Homo sapiens ] |
| Official Symbol : | SIX1 |
| Synonyms : | SIX1; SIX homeobox 1; deafness, autosomal dominant 23 , DFNA23, sine oculis homeobox (Drosophila) homolog 1 , sine oculis homeobox homolog 1 (Drosophila); homeobox protein SIX1; |
| Gene ID : | 6495 |
| mRNA Refseq : | NM_005982 |
| Protein Refseq : | NP_005973 |
| MIM : | 601205 |
| Uniprot ID : | Q15475 |
| Chromosome Location : | 14q23.1 |
| Pathway : | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
| Function : | DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
Products Types
| ◆ Recombinant Protein | ||
| SIX1-7160H | Recombinant Human SIX Homeobox 1, His-tagged | +Inquiry |
| SIX1-3477C | Recombinant Chicken SIX1 | +Inquiry |
| ◆ Lysates | ||
| SIX1-1825HCL | Recombinant Human SIX1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
