"CSF1" Related Products

Expand
Expand

Recombinant Human Colony Stimulating Factor 1 (Macrophage)

Cat. No.: CSF1-167H
Product Overview: Recombinant Human interleukin 4 encoding the N-terminal 190 amino acids of the human Macrophage Colony-Stimulating Factor 1 (M-CSF) protein and was expressed in modifiedhuman 293 cells.
Description: M-CSF (macrophage colony stimulating factor), also known as colony stimulating factor-1 (CSF-1), is a homodimeric glycoprotein the subunits of which are linked by disulfide bonds. Different splice variants of M-CSF have been found which differ at the C-terminus.
Source: Human 293 cells.
Amino Acid Sequence: EEVSEYCSHMIGSGH LQSLQRLIDSQME TSCQITFEFV DQEQLKDPV CYLKK AFL LV QD I ME DTMR FRDNTPNAIA IVQLQELSLR LK SCFTK DYEEH DKACV RTF YE TPLQL LE K V KNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN.
Molecular Mass: Under reducing conditionsM-CSFmigrates as two bands between 20 and 35 kDa in SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified M-CSF that has a predicted molecular mass of 18.4 kDa.
PI: M-CSF separates into a number of isoforms with a pI between 3.5 and 5 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified M-CSF that has a predicted pI of 4.8.
% Carbohydrate: Purified M-CSF consists of 0–50% carbohydrate by weight.
Glycosylation: M-CSF contains N- and O-linked oligosaccharides.
Purity: >95%, as determined by SDS-PAGE and visualised by Coomassie Brilliant Blue.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilised products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity: The ED50of M-CSF is typically 5–15 ng /ml as measured in a cell proliferation assay using the M-CSF dependent mouse monocytic mNFS-60 cell line.
Gene Name: CSF1 colony stimulating factor 1 (macrophage) [ Homo sapiens ]
Synonyms: CSF1; colony stimulating factor 1 (macrophage); MCSF; MGC31930; OTTHUMP00000013363; OTTHUMP00000013364; colony stimulating factor 1; macrophage colony stimulating factor; OTTHUMP00000013362
Gene ID: 1435
mRNA Refseq: NM_000757
Protein Refseq: NP_000748
MIM: 120420
UniProt ID: P09603
Chromosome Location: 1q21-p13
Pathway: Cytokine-cytokine receptor interaction; Hematopoietic cell lineage
Function: cytokine activity; growth factor activity; protein binding; macrophage colony stimulating factor receptor binding; protein homodimerization activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.