Active Recombinant Mouse Csf1 Protein

Cat.No. : Csf1-222C
Product Overview : Recombinant Mouse Csf1 Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : CHO
Description : Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 3 ng/mL, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 3.3 × 10^5 units/mg.
Molecular Mass : 35-44 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant murine Macrophage-Colony Stimulating Factor (M-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmM-CSF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Csf1 colony stimulating factor 1 (macrophage) [ Mus musculus ]
Official Symbol Csf1
Synonyms CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; osteopetrosis; op; Csfm; MCSF; C87615;
Gene ID 12977
mRNA Refseq NM_001113529
Protein Refseq NP_001107001
UniProt ID P07141

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf1 Products

Required fields are marked with *

My Review for All Csf1 Products

Required fields are marked with *

0
cart-icon