Recombinant Human CSF1 Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CSF1-198H |
| Product Overview : | CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757350) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011] |
| Molecular Mass : | 29 kDa |
| AA Sequence : | MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGSSSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CSF1 colony stimulating factor 1 (macrophage) [ Homo sapiens (human) ] |
| Official Symbol | CSF1 |
| Synonyms | CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; M CSF; MCSF; MGC31930; lanimostim; CSF-1; |
| Gene ID | 1435 |
| mRNA Refseq | NM_172211 |
| Protein Refseq | NP_757350 |
| MIM | 120420 |
| UniProt ID | P09603 |
| ◆ Recombinant Proteins | ||
| CSF1-565H | Active Recombinant Human CSF1 protein, His-tagged | +Inquiry |
| CSF1-2156HF | Recombinant Full Length Human CSF1 Protein, GST-tagged | +Inquiry |
| CSF1-3337H | Recombinant Human CSF1 Protein, MYC/DDK-tagged | +Inquiry |
| Csf1-041E | Active Recombinant Mouse Csf1 (33-262aa), Met tagged | +Inquiry |
| Csf1-290M | Active Recombinant Mouse Csf1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSF1-1934HCL | Recombinant Human CSF1 cell lysate | +Inquiry |
| CSF1-001MCL | Recombinant Mouse CSF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF1 Products
Required fields are marked with *
My Review for All CSF1 Products
Required fields are marked with *



