"DDX50" Related Products

Expand
Expand

Recombinant Human DDX50, His-tagged

Cat.No.: DDX50-28327TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-270 of Human DDX50 with N terminal His tag; Predicted MWt 32 kDa.
Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing. This gene and DDX21, also called RH-II/GuA, have similar genomic structures and are in tandem orientation on chromosome 10, suggesting that the two genes arose by gene duplication in evolution. This gene has pseudogenes on chromosomes 2, 3 and 4. Alternative splicing of this gene generates multiple transcript variants, but the full length nature of all the other variants but one has not been defined.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 107 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MPGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYD SDEKSETRENGVTDDLDAPKAKKSKMKEKLNGDTEEGF NRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDT STHKSSDNKLEETLTREQKEGAFSNFPISEETIKLLKG RGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIP LIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFK DITRKLSVACFYGGTSYQSQINHIRNGIDILVGTPGRI
Sequence Similarities: Belongs to the DEAD box helicase family. DDX21/DDX50 subfamily.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.
Gene Name: DDX50 DEAD (Asp-Glu-Ala-Asp) box polypeptide 50 [ Homo sapiens ]
Official Symbol: DDX50
Synonyms: DDX50; DEAD (Asp-Glu-Ala-Asp) box polypeptide 50; ATP-dependent RNA helicase DDX50; GU2; GUB; MGC3199; RH II/GuB;
Gene ID: 79009
mRNA Refseq: NM_024045
Protein Refseq: NP_076950
MIM: 610373
Uniprot ID: Q9BQ39
Chromosome Location: 10q22.2
Function: ATP binding; ATP-dependent helicase activity; RNA binding; helicase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.