"HSPA6" Related Products

Expand

Recombinant Human HSPA6

Cat.No.: HSPA6-26542TH
Product Overview: Recombinant full length Human HSPA6 expressed in Saccharomyces cerevisiae; amino acids 1-643 , 71kDa.
Description: HSP70B is a unique member of the human Hsp70 chaperone involved in cellular processes such as protein trafficking, folding, and prevention of aggregation.
Form: Liquid
Purity: Immunogen affinity purified
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTT PSYVAFTDTERLVGDAAKSQAALNPHNTVFDAKRLIGR KFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTF YPEEISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQ RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGE RNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGG EDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTACERA KRTLSSSTQATLEIDSLFEGVDFYTSITRARFEELCSD LFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKV QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAVLMGDKCE KVQDLLLLDVAPLSLGLETAGGVMTTLIQRNATIPTKQ TQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELS GIPPAPRGVPQIEVTFDIDANGILSVTATDRSTGKANKIT ITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKN SLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVL AWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPG GSSCGTQARQGDPSTGPIIEEVD
Sequence Similarities: Belongs to the heat shock protein 70 family.
Gene Name: HSPA6 heat shock 70kDa protein 6 (HSP70B) [ Homo sapiens ]
Official Symbol: HSPA6
Synonyms: HSPA6; heat shock 70kDa protein 6 (HSP70B); heat shock 70kD protein 6 (HSP70B); heat shock 70 kDa protein 6;
Gene ID: 3310
mRNA Refseq: NM_002155
Protein Refseq: NP_002146
MIM: 140555
Uniprot ID: P17066
Chromosome Location: 1q23.3
Pathway: Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Influenza A, organism-specific biosystem;
Function: ATP binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.