Recombinant Human HSPA6 Protein, GST-tagged
| Cat.No. : | HSPA6-5110H |
| Product Overview : | Human HSPA6 partial ORF ( NP_002146.2, 544 a.a. - 643 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HSPA6 (Heat Shock Protein Family A (Hsp70) Member 6) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway and Proteolysis Role of Parkin in the Ubiquitin-Proteasomal Pathway. GO annotations related to this gene include enzyme binding and heat shock protein binding. An important paralog of this gene is HSPA1B. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | LEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSPA6 heat shock 70kDa protein 6 (HSP70B) [ Homo sapiens ] |
| Official Symbol | HSPA6 |
| Synonyms | HSPA6; heat shock 70kDa protein 6 (HSP70B); heat shock 70kD protein 6 (HSP70B); heat shock 70 kDa protein 6; heat shock 70 kDa protein B; |
| Gene ID | 3310 |
| mRNA Refseq | NM_002155 |
| Protein Refseq | NP_002146 |
| MIM | 140555 |
| UniProt ID | P17066 |
| ◆ Recombinant Proteins | ||
| HSPA6-1120H | Recombinant Human HSPA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HSPA6-5110H | Recombinant Human HSPA6 Protein, GST-tagged | +Inquiry |
| HSPA6-3089H | Recombinant Human HSPA6 Protein (Met1-Cys387), N-His tagged | +Inquiry |
| HSPA6-1811H | Recombinant Human Heat Shock 70kDa Protein 6 (HSP70B), His-tagged | +Inquiry |
| HSPA6-26542TH | Recombinant Human HSPA6 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPA6-5354HCL | Recombinant Human HSPA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPA6 Products
Required fields are marked with *
My Review for All HSPA6 Products
Required fields are marked with *
