"NR4A1" Related Products

Expand
Expand
Expand

Recombinant Human NR4A1

Cat.No.: NR4A1-30494TH
Product Overview: Recombinant full length Human NUR77 with N terminal proprietary tag; Predicted MWt 91.85 kDa.
Description: This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 598 amino acids
Molecular Weight: 91.850kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Fetal muscle and adult liver, brain and thyroid.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASP EAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSS ASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPV DEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGH FSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSP SLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHL EGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYG VRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQ FCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDAS PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDA GDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLE SAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFG DWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQE PRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLP ELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
Sequence Similarities: Belongs to the nuclear hormone receptor family. NR4 subfamily.Contains 1 nuclear receptor DNA-binding domain.
Gene Name: NR4A1 nuclear receptor subfamily 4, group A, member 1 [ Homo sapiens ]
Official Symbol: NR4A1
Synonyms: NR4A1; nuclear receptor subfamily 4, group A, member 1; GFRP1, HMR; nuclear receptor subfamily 4 group A member 1; N10; NAK 1; NGFIB; NUR77; TR3;
Gene ID: 3164
mRNA Refseq: NM_001202233
Protein Refseq: NP_001189162
MIM: 139139
Uniprot ID: P22736
Chromosome Location: 12q13
Pathway: AKT phosphorylates targets in the nucleus, organism-specific biosystem; Downstream signal transduction, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; GAB1 signalosome, organism-specific biosystem; Gene Expression, organism-specific biosystem;
Function: DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; ligand-dependent nuclear receptor activity; ligand-dependent nuclear receptor activi;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.