"TNFSF11" Related Products

Expand
Expand

Recombinant Human TNFSF11

Cat.No.: TNFSF11-31288TH
Product Overview: Highly pure (>98%) recombinant human sRANKL.
Description: This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found.
Source: E. coli
Tissue specificity: Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid.
Form: Lyophilised
Storage buffer: Formulized from 5mM Sodium Phosphate, pH 7.6 + 75 mM NaCl.
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: hsRANK-L is a soluble 20.0 kDa protein, comprising the full-length of the TNF-like extracellular domain of RANKL:MEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSW YHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRH HETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGST KYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSL LDPDQDATYFGAFKVRDID
Sequence Similarities: Belongs to the tumor necrosis factor family.
Gene Name: TNFSF11 tumor necrosis factor (ligand) superfamily, member 11 [ Homo sapiens ]
Official Symbol: TNFSF11
Synonyms: TNFSF11; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand superfamily member 11; CD254; ODF; OPGL; RANKL; TRANCE;
Gene ID: 8600
mRNA Refseq: NM_003701
Protein Refseq: NP_003692
MIM: 602642
Uniprot ID: O14788
Chromosome Location: 13q14
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL6-mediated signaling events, organism-specific biosystem; Osteoblast Signaling, organism-specific biosystem; Osteoclast Signaling, organism-specific biosystem;
Function: cytokine activity; cytokine activity; receptor activity; tumor necrosis factor receptor binding; tumor necrosis factor receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.