"ITGB2" Related Products

Expand
Expand
Expand

Recombinant Human ITGB2

Cat.No.: ITGB2-26324TH
Product Overview: Recombinant full length Human CD18 protein with an N terminal proprietary tag; predicted mwt: 110.66 kDa inclusive of tag.
Description: The product of this gene belongs to the integrin beta chain family of proteins. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. This gene encodes the integrin beta chain beta 2. A given chain may combine with multiple partners resulting in different integrins. For example, beta 2 combines with the alpha L chain to form the integrin LFA-1, and combines with the alpha M chain to form the integrin Mac-1. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Defects in this gene are the cause of leukocyte adhesion deficiency type I (LAD1). Two transcript variants encoding the same protein have been identified for this gene.
Protein length: 769 amino acids
Molecular Weight: 110.660kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESG PGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMD PTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEI TESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQP PFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILT PNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIF AVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAY NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDC DGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQ VLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCH TSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCG KCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFG KNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQD GMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTT VMNPKFAES
Sequence Similarities: Belongs to the integrin beta chain family.Contains 1 VWFA domain.
Gene Name: ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) [ Homo sapiens ]
Official Symbol: ITGB2
Synonyms: ITGB2; integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); CD18, integrin, beta 2 (antigen CD18 (p95), lymphocyte function associated antigen 1; macrophage antigen 1 (mac 1) beta subunit) , MFI7; integrin beta-2; LFA 1; MAC 1;
Gene ID: 3689
mRNA Refseq: NM_000211
Protein Refseq: NP_000202
MIM: 600065
Uniprot ID: P05107
Chromosome Location: 21q22.3
Pathway: Adaptive Immune System, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; CXCR3-mediated signaling events, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem;
Function: binding; glycoprotein binding; protein kinase binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.