Recombinant Human ITGB2 protein(451-520 aa), C-His-tagged
Cat.No. : | ITGB2-2556H |
Product Overview : | Recombinant Human ITGB2 protein(P05107)(451-520 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 451-520 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCH |
Gene Name | ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) [ Homo sapiens ] |
Official Symbol | ITGB2 |
Synonyms | ITGB2; integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); CD18, integrin, beta 2 (antigen CD18 (p95), lymphocyte function associated antigen 1; macrophage antigen 1 (mac 1) beta subunit) , MFI7; integrin beta-2; LFA 1; MAC 1; integrin beta chain, beta 2; complement receptor C3 beta-subunit; complement receptor C3 subunit beta; leukocyte cell adhesion molecule CD18; leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C; cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; cell surface adhesion glycoprotein LFA-1/CR3/P150,959 beta subunit precursor); LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1; |
Gene ID | 3689 |
mRNA Refseq | NM_000211 |
Protein Refseq | NP_000202 |
MIM | 600065 |
UniProt ID | P05107 |
◆ Recombinant Proteins | ||
ITGB2-26324TH | Recombinant Human ITGB2 | +Inquiry |
ITGB2-1067H | Recombinant Human ITGB2 Protein, His-tagged | +Inquiry |
ITGB2-4326H | Recombinant Human ITGB2 Protein (Met1-Asn700), C-His tagged | +Inquiry |
ITGB2-4978H | Recombinant Human ITGB2 Protein, GST-tagged | +Inquiry |
ITGB2-1216H | Recombinant Human ITGB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB2-5125HCL | Recombinant Human ITGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGB2 Products
Required fields are marked with *
My Review for All ITGB2 Products
Required fields are marked with *
0
Inquiry Basket