Recombinant Human ITGB2 protein(451-520 aa), C-His-tagged
| Cat.No. : | ITGB2-2556H |
| Product Overview : | Recombinant Human ITGB2 protein(P05107)(451-520 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 451-520 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCH |
| Gene Name | ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) [ Homo sapiens ] |
| Official Symbol | ITGB2 |
| Synonyms | ITGB2; integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); CD18, integrin, beta 2 (antigen CD18 (p95), lymphocyte function associated antigen 1; macrophage antigen 1 (mac 1) beta subunit) , MFI7; integrin beta-2; LFA 1; MAC 1; integrin beta chain, beta 2; complement receptor C3 beta-subunit; complement receptor C3 subunit beta; leukocyte cell adhesion molecule CD18; leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C; cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; cell surface adhesion glycoprotein LFA-1/CR3/P150,959 beta subunit precursor); LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1; |
| Gene ID | 3689 |
| mRNA Refseq | NM_000211 |
| Protein Refseq | NP_000202 |
| MIM | 600065 |
| UniProt ID | P05107 |
| ◆ Recombinant Proteins | ||
| ITGB2-26325TH | Recombinant Human ITGB2 | +Inquiry |
| ITGB2-1922H | Recombinant Human ITGB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RFL20219MF | Recombinant Full Length Mouse Integrin Beta-2(Itgb2) Protein, His-Tagged | +Inquiry |
| ITGB2-1052H | Recombinant Human ITGB2 Protein (Gly124-Leu363), N-GST tagged | +Inquiry |
| ITGB2-2556H | Recombinant Human ITGB2 protein(451-520 aa), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGB2-5125HCL | Recombinant Human ITGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB2 Products
Required fields are marked with *
My Review for All ITGB2 Products
Required fields are marked with *



