"CLEC4M" Related Products

Expand
Expand

Recombinant Human CLEC4M, FC-tagged

Cat.No.: CLEC4M-26929TH
Product Overview: Recombinant fragment corresponding to extracellular domain amino acids 71-398 of Human CD299, fused to the Fc region of Human IgG1 (aa 93-330). The chimeric protein was expressed in modified Human 293 cells using a DNA sequence encoding the signal peptide
Description: This gene encodes a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are common and have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 30835; often referred to as DC-SIGN or CD209). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.
Conjugation: Fc
Tissue specificity: Predominantly highly expressed in liver sinusoidal endothelial cells and in lymph node. Found in placental endothelium but not in macrophages. Expressed in type II alveolar cells and lung endothelial cells.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C.
Sequences of amino acids: Theoretical sequence:HGTELPSPPSKLQVSKVPSSLSQEQSEQD AIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGE LPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELT RLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGEL PDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNC YFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQL QTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYW NSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDGIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK
Sequence Similarities: Contains 1 C-type lectin domain.
Gene ID: CLEC4M C-type lectin domain family 4, member M [ Homo sapiens ]
Official Symbol: CLEC4M
Synonyms: CLEC4M; C-type lectin domain family 4, member M; CD209L, CD299, CD299 antigen; C-type lectin domain family 4 member M; DC SIGN2; DC SIGNR; DCSIGNR; HP10347; LSIGN;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.