Recombinant Human CLEC4M Protein, GST-tagged
| Cat.No. : | CLEC4M-1471H |
| Product Overview : | Human CLEC4M partial ORF ( NP_055072, 285 a.a. - 394 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are common and have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 30835; often referred to as DC-SIGN or CD209). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.[provided by RefSeq, Feb 2009] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | SQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLEC4M C-type lectin domain family 4, member M [ Homo sapiens ] |
| Official Symbol | CLEC4M |
| Synonyms | CLEC4M; C-type lectin domain family 4, member M; CD209L, CD299, CD299 antigen; C-type lectin domain family 4 member M; DC SIGN2; DC SIGNR; DCSIGNR; HP10347; LSIGN; CD299 antigen; DC-SIGN-related protein; CD209 antigen-like protein 1; mannose binding C-type lectin DC-SIGNR; dendritic cell-specific ICAM-3-grabbing non-integrin 2; liver/lymph node-specific ICAM-3 grabbing non-integrin; liver/lymph node-specific ICAM-3-grabbing non-integrin; CD299; CD209L; L-SIGN; DC-SIGN2; DC-SIGNR; MGC47866; MGC129964; |
| Gene ID | 10332 |
| mRNA Refseq | NM_001144904 |
| Protein Refseq | NP_001138376 |
| MIM | 605872 |
| UniProt ID | Q9H2X3 |
| ◆ Recombinant Proteins | ||
| CLEC4M-6556H | Recombinant Human CLEC4M Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CLEC4M-1855H | Recombinant Human CLEC4M protein, His & T7-tagged | +Inquiry |
| CLEC4M-007H | Recombinant Human CLEC4M Protein, His-tagged | +Inquiry |
| CLEC4M-08H | Recombinant Human CLEC4M(Ser73-Glu376) Protein, N-8*His-Flag-tagged | +Inquiry |
| CLEC4M-151H | Recombinant Human CLEC4M Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLEC4M-2744HCL | Recombinant Human CLEC4M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC4M Products
Required fields are marked with *
My Review for All CLEC4M Products
Required fields are marked with *
