"DUSP3" Related Products

Expand
Expand

Recombinant Human DUSP3, His-tagged

Cat.No.: DUSP3-26911TH
Product Overview: Recombinant full-length Human DUSP3 with a N terminal His tag; 205aa, 23 kDa.
Description: The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene maps in a region that contains the BRCA1 locus which confers susceptibility to breast and ovarian cancer. Although DUSP3 is expressed in both breast and ovarian tissues, mutation screening in breast cancer pedigrees and in sporadic tumors was negative, leading to the conclusion that this gene is not BRCA1.
Protein length: 205 amino acids
Conjugation: HIS
Molecular Weight: 23.000kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.04% DTT, 0.88% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Sequence Similarities: Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain.
Gene Name: DUSP3 dual specificity phosphatase 3 [ Homo sapiens ]
Official Symbol: DUSP3
Synonyms: DUSP3; dual specificity phosphatase 3; vaccinia virus phosphatase VH1 related , VHR; dual specificity protein phosphatase 3;
Gene ID: 1845
mRNA Refseq: NM_004090
Protein Refseq: NP_004081
MIM: 600183
Uniprot ID: P51452
Chromosome Location: 17q21
Pathway: Activated TLR4 signalling, organism-specific biosystem; ERK/MAPK targets, organism-specific biosystem; ERKs are inactivated, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem;
Function: MAP kinase phosphatase activity; hydrolase activity; phosphatase activity; protein tyrosine phosphatase activity; protein tyrosine phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.