"TRIM63" Related Products

Expand
Expand
Expand

Recombinant Human TRIM63

Cat.No.: TRIM63-30260TH
Product Overview: Recombinant fragment corresponding to amino acids 254-352 of Human MURF1 with a proprietary tag; Predicted MWt 36.52 kDa.
Description: This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is localized to the Z-line and M-line lattices of myofibrils, where titins N-terminal and C-terminal regions respectively bind to the sarcomere. In vitro binding studies have shown that this protein also binds directly to titin near the region of titin containing kinase activity. Another member of this protein family binds to microtubules. Since these family members can form heterodimers, this suggests that these proteins may serve as a link between titin kinase and microtubule-dependent signal pathways in muscle.
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Muscle specific. Selectively expressed in heart and skeletal muscle. Also expressed in the iris.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGH
Sequence Similarities: Contains 1 B box-type zinc finger.Contains 1 COS domain.Contains 1 RING-type zinc finger.
Gene Name: TRIM63 tripartite motif containing 63 [ Homo sapiens ]
Official Symbol: TRIM63
Synonyms: TRIM63; tripartite motif containing 63; ring finger protein 28 , RNF28, tripartite motif containing 63; E3 ubiquitin-protein ligase TRIM63; IRF; iris ring finger protein; MURF 1; muscle specific RING finger protein 1; SMRZ; striated muscle RING zinc fing
Gene ID: 84676
mRNA Refseq: NM_032588
Protein Refseq: NP_115977
MIM: 606131
Uniprot ID: Q969Q1
Chromosome Location: 1p34-p33
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function: ligase activity; metal ion binding; signal transducer activity; titin binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.