"TNFRSF8" Related Products

Expand
Expand

Recombinant Human TNFRSF8

Cat.No.: TNFRSF8-26927TH
Product Overview: Recombinant fragment of Human CD30 with proprietarytag; Predicted MWt 38.06 kDa inclusive of tag.
Description: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Protein length: 113 amino acids
Molecular Weight: 38.060kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPA
Sequence Similarities: Contains 6 TNFR-Cys repeats.
Gene Name: TNFRSF8 tumor necrosis factor receptor superfamily, member 8 [ Homo sapiens ]
Official Symbol: TNFRSF8
Synonyms: TNFRSF8; tumor necrosis factor receptor superfamily, member 8; CD30, D1S166E; tumor necrosis factor receptor superfamily member 8; KI 1;
Gene ID: 943
mRNA Refseq: NM_001243
Protein Refseq: NP_001234
MIM: 153243
Uniprot ID: P28908
Chromosome Location: 1p36
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function: binding; receptor activity; transmembrane signaling receptor activity; tumor necrosis factor-activated receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.