Recombinant Human TNFRSF8 Protein, His-tagged
| Cat.No. : | TNFRSF8-145H |
| Product Overview : | Recombinant human TNFRSF8 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 595 |
| Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported |
| Form : | Lyophilized |
| Molecular Mass : | 39.3 kDa |
| AA Sequence : | MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | TNFRSF8 tumor necrosis factor receptor superfamily, member 8 [ Homo sapiens (human) ] |
| Official Symbol | TNFRSF8 |
| Synonyms | TNFRSF8; tumor necrosis factor receptor superfamily, member 8; CD30, D1S166E; tumor necrosis factor receptor superfamily member 8; KI 1; Ki-1 antigen; CD30L receptor; cytokine receptor CD30; lymphocyte activation antigen CD30; CD30; Ki-1; D1S166E; |
| Gene ID | 943 |
| mRNA Refseq | NM_001243 |
| Protein Refseq | NP_001234 |
| MIM | 153243 |
| UniProt ID | P28908 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF8 Products
Required fields are marked with *
My Review for All TNFRSF8 Products
Required fields are marked with *



