Recombinant Human FGF2, StrepII-tagged FGF2-293H

Recombinant Human FGF2, StrepII-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FGF2, StrepII-tagged

Recombinant Human FGF2, StrepII-tagged

FGF2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FGF2-293H
Product Overview : Purified, full-length human recombinant bFGF (FGF2) protein (amino acids 2-288, 287 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 30.6 kDa. (Accession NP_001997.5; UniProt P09038)
Description : FGF2 is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. It plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration, and has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth.
Source : Human Cells
Species : Human
Tag : StrepII
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
Protein length : 2-288, 287 a.a.
AA Sequence : VGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSG SRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGS GAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLA SKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Endotoxin : <0.1 eu per μg protein by lal
Purity : 85% by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month.
Gene Name : FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens ]
Official Symbol : FGF2
Synonyms : FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2;
Gene ID : 2247
mRNA Refseq : NM_002006
Protein Refseq : NP_001997
MIM : 134920
UniProt ID : P09038
Chromosome Location : 4q26
Pathway : Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR1 ligand binding and activation, organism-specific biosystem; FGFR1b ligand binding and activation, organism-specific biosystem; FGFR1c ligand binding and activation, organism-specific biosystem;
Function : chemoattractant activity; cytokine activity; fibroblast growth factor binding; fibroblast growth factor receptor binding; growth factor activity; heparin binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; protein tyrosine kinase activity; voltage-gated calcium channel activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy