Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SLC3A2

Cat.No. : SLC3A2-26956TH
Product Overview : Recombinant fragment of Human CD98 with N terminal proprietary tag; pedicted MWt: 37.73 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed ubiquitously in all tissues tested with highest levels detected in kidney, placenta and testis and weakest level in thymus. During gestation, expression in the placenta was significantly stronger at full-term than at the mid-trimester stage. Exp
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : IIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLA GLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDP NFGSKEDFDSLLQSAKKKSIRVILDLTPNY
Sequence Similarities : Belongs to the SLC3A transporter family.
Gene Name : SLC3A2 solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 [ Homo sapiens ]
Official Symbol : SLC3A2
Synonyms : SLC3A2; solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2; MDU1; 4F2 cell-surface antigen heavy chain; 4F2; 4F2 cell surface antigen heavy chain; 4F2 heavy chain; 4F2HC; 4T2HC; antigen defined by monoclonal 4F2;
Gene ID : 6520
mRNA Refseq : NM_001012662
Protein Refseq : NP_001012680
MIM : 158070
Uniprot ID : P08195
Chromosome Location : 11q12-q22
Pathway : Amino acid transport across the plasma membrane, organism-specific biosystem; Basigin interactions, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function : calcium:sodium antiporter activity; catalytic activity; cation binding; neutral amino acid transmembrane transporter activity; protein binding;

Products Types

◆ Recombinant Protein
SLC3A2-229H Recombinant Human SLC3A2 Protein, His-tagged +Inquiry
SLC3A2-1057H Recombinant Human SLC3A2 protein(Arg206-Ala630), His-tagged, Biotinylated +Inquiry
SLC3A2-5197R Recombinant Rat SLC3A2 Protein, His (Fc)-Avi-tagged +Inquiry
SLC3A2-2593H Recombinant Human SLC3A2 protein(271-370 aa), C-hFc & C-His-tagged +Inquiry
Slc3a2-7031M Recombinant Mouse Slc3a2 protein(Ala139-Ala565), His-tagged +Inquiry

See All SLC3A2 Recombinant Protein

◆ Lysates
SLC3A2-1772MCL Recombinant Mouse SLC3A2 cell lysate +Inquiry
SLC3A2-1199RCL Recombinant Rat SLC3A2 cell lysate +Inquiry
SLC3A2-2015HCL Recombinant Human SLC3A2 cell lysate +Inquiry

See All SLC3A2 Lysates

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends