Recombinant Human SLC3A2 protein(271-370 aa), C-hFc & C-His-tagged
Cat.No. : | SLC3A2-2593H |
Product Overview : | Recombinant Human SLC3A2 protein(P08195)(271-370 aa), fused with C-terminal hFc and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Protein Length : | 271-370 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGF |
Gene Name | SLC3A2 solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 [ Homo sapiens ] |
Official Symbol | SLC3A2 |
Synonyms | SLC3A2; solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2; MDU1; 4F2 cell-surface antigen heavy chain; 4F2; 4F2 cell surface antigen heavy chain; 4F2 heavy chain; 4F2HC; 4T2HC; antigen defined by monoclonal 4F2; antigen identified by monoclonal antibodies 4F2; TRA1.10; TROP4; and T43; CD98; CD98 heavy chain; CD98HC; heavy chain; lymphocyte activation antigen 4F2 large subunit; monoclonal 44D7; NACAE; antigen defined by monoclonal 4F2, heavy chain; antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43; |
Gene ID | 6520 |
mRNA Refseq | NM_001012662 |
Protein Refseq | NP_001012680 |
MIM | 158070 |
UniProt ID | P08195 |
◆ Recombinant Proteins | ||
Slc3a2-7031M | Recombinant Mouse Slc3a2 protein(Ala139-Ala565), His-tagged | +Inquiry |
SLC3A2-5107H | Recombinant Human SLC3A2 Protein (Arg206-Ala630), C-His tagged | +Inquiry |
Slc3a2-1197R | Recombinant Rat Slc3a2 protein, His & GST-tagged | +Inquiry |
SLC3A2-2768H | Recombinant Human SLC3A2 protein, His-tagged | +Inquiry |
SLC3A2-1037H | Recombinant Human SLC3A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC3A2-1199RCL | Recombinant Rat SLC3A2 cell lysate | +Inquiry |
SLC3A2-2015HCL | Recombinant Human SLC3A2 cell lysate | +Inquiry |
SLC3A2-1772MCL | Recombinant Mouse SLC3A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC3A2 Products
Required fields are marked with *
My Review for All SLC3A2 Products
Required fields are marked with *