Recombinant Mouse Stc2 Protein, 25-296aa, C-His tagged

Cat.No. : STC2-16118M
Product Overview : Recombinant Mouse Stc2 Protein (25-296aa) with C-His tag was expressed in hek293.
Availability June 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 25-296aa
Description : Predicted to enable enzyme binding activity; heme binding activity; and protein homodimerization activity. Acts upstream of or within several processes, including cellular calcium ion homeostasis; endoplasmic reticulum unfolded protein response; and regulation of store-operated calcium entry. Located in Golgi apparatus and endoplasmic reticulum. Is expressed in several structures, including embryo mesenchyme; genitourinary system; gut; olfactory epithelium; and vertebral axis musculature. Orthologous to human STC2 (stanniocalcin 2).
Form : Liquid
Molecular Mass : Theoretical molecular weight: ~ 30 kDa including His tag.
AA Sequence : TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRRHHHHHH
Purity : > 90% as determined by SDS-PAGE
Storage : Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.72 mg/mL
Storage Buffer : PBS, pH 7.4
Publications :
Histidine-Rich Glycoprotein and Stanniocalcin-2 High Affinity Interactions with Inflammatory Cells (2022)
Quartz Crystal Microbalance Measurement of Histidine-Rich Glycoprotein and Stanniocalcin-2 Binding to Each Other and to Inflammatory Cells (2021)
Leukocyte differentiation by histidine-rich glycoprotein/stanniocalcin-2 complex regulates murine glioma growth through modulation of antitumor immunity (2018)
Gene Name Stc2 stanniocalcin 2 [ Mus musculus (house mouse) ]
Official Symbol Stc2
Synonyms Stc2; stanniocalcin 2; Stc-2; Stc2l; mustc2; stanniocalcin-2
Gene ID 20856
mRNA Refseq NM_011491
Protein Refseq NP_035621
UniProt ID O88452

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Stc2 Products

Required fields are marked with *

My Review for All Stc2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon